EMILIN1 Polyclonal AntibodyEMILIN1 Polyclonal Antibody
Move your mouse over image or click to enlarge

EMILIN1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4488-200ul 200ul
£332.50
A4488-100ul 100ul
£192.50
A4488-50ul 50ul
£113.75
A4488-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4488
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names EMILIN1; EMI; EMILIN; gp115; EMILIN-1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 817-1016 of human EMILIN1 (NP_008977.1).
Reactivity Human
Gene ID 11117
Calculated MW 35kDa/106kDa
Observed MW 135kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GEAGPPGPPGLQGPPGPAGPPGSPGKDGQEGPIGPPGPQGEQGVEGAPAAPVPQVAFSAALSLPRSEPGTVPFDRVLLNDGGYYDPETGVFTAPLAGRYLLSAVLTGHRHEKVEAVLSRSNQGVARVDSGGYEPEGLENKPVAESQPSPGTLGVFSLILPLQAGDTVCVDLVMGQLAHSEEPLTIFSGALLYGDPELEHA
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents