EMCN Polyclonal AntibodyEMCN Polyclonal Antibody
Move your mouse over image or click to enlarge

EMCN Polyclonal Antibody

Cat# Size Price Qty Buy
A14131-200ul 200ul
£332.50
A14131-100ul 100ul
£192.50
A14131-50ul 50ul
£113.75
A14131-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14131
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names EMCN; EMCN2; MUC14; endomucin
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human EMCN (NP_057326.2).
Reactivity Human, Mouse, Rat
Gene ID 51705
Calculated MW 18kDa/26kDa/27kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTT
Sensitivity WB,1:500 - 1:2000|IHC,1:100 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents