ELSPBP1 Polyclonal AntibodyELSPBP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ELSPBP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A15882-20ul 20ul
£77.00
A15882-50ul 50ul
£113.75
A15882-100ul 100ul
£192.50
A15882-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15882
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ELSPBP1; E12; EDDM12; EL149; HE12; epididymal sperm-binding protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-223 of human ELSPBP1 (NP_071425.3).
Reactivity Mouse, Rat
Gene ID 64100
Calculated MW 26kDa
Observed MW 26kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QQWKFCETNEYGGNSLRKPCIFPSIYRNNVVSDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNEGSKENLVWCATSYNYDQDHTWVYC
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents