ELOVL4 Polyclonal AntibodyELOVL4 Polyclonal Antibody
Move your mouse over image or click to enlarge

ELOVL4 Polyclonal Antibody

Cat# Size Price Qty Buy
A3639-200ul 200ul
£332.50
A3639-100ul 100ul
£192.50
A3639-50ul 50ul
£113.75
A3639-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3639
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ELOVL4; ADMD; CT118; ISQMR; SCA34; STGD2; STGD3; ELOVL fatty acid elongase 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ELOVL4 (NP_073563.1).
Reactivity Human
Gene ID 6785
Calculated MW 36kDa
Observed MW 37kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents