ELF3 Polyclonal AntibodyELF3 Polyclonal Antibody
Move your mouse over image or click to enlarge

ELF3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13489-200ul 200ul
£332.50
A13489-100ul 100ul
£192.50
A13489-50ul 50ul
£113.75
A13489-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13489
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ELF3; EPR-1; ERT; ESE-1; ESX; E74 like ETS transcription factor 3
Applications IF, IHC, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ELF3 (NP_004424.3).
Reactivity Human, Mouse
Gene ID 1999
Calculated MW 39kDa/41kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200|IP,1:20 - 1:50
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents