EIF4EBP2 Polyclonal AntibodyEIF4EBP2 Polyclonal Antibody
Move your mouse over image or click to enlarge

EIF4EBP2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13691-200ul 200ul
£332.50
A13691-100ul 100ul
£192.50
A13691-50ul 50ul
£113.75
A13691-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13691
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names EIF4EBP2; 4EBP2; PHASII; eukaryotic translation initiation factor 4E-binding protein 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 61-120 of human EIF4EBP2 (NP_004087.1).
Reactivity Human
Gene ID 1979
Calculated MW 12kDa
Observed MW 16kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents