EIF4A3 Polyclonal AntibodyEIF4A3 Polyclonal Antibody
Move your mouse over image or click to enlarge

EIF4A3 Polyclonal Antibody

Cat# Size Price Qty Buy
A4338-200ul 200ul
£332.50
A4338-100ul 100ul
£192.50
A4338-50ul 50ul
£113.75
A4338-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4338
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names EIF4A3; DDX48; MUK34; NMP265; NUK34; RCPS; eIF4AIII; Fal1; eukaryotic initiation factor 4A-III
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human EIF4A3 (NP_055555.1).
Reactivity Human, Mouse, Rat
Gene ID 9775
Calculated MW 46kDa
Observed MW 47kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPP
Sensitivity WB,1:1000 - 1:3000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents