EIF2S2 Polyclonal AntibodyEIF2S2 Polyclonal Antibody
Move your mouse over image or click to enlarge

EIF2S2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14498-200ul 200ul
£332.50
A14498-100ul 100ul
£192.50
A14498-50ul 50ul
£113.75
A14498-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14498
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names EIF2S2; EIF2; EIF2B; EIF2beta; PPP1R67; eIF-2-beta; eukaryotic translation initiation factor 2 subunit 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human EIF2S2 (NP_003899.2).
Reactivity Human, Mouse, Rat
Gene ID 8894
Calculated MW 38kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents