EGF Polyclonal AntibodyEGF Polyclonal Antibody
Move your mouse over image or click to enlarge

EGF Polyclonal Antibody

Cat# Size Price Qty Buy
A13615-200ul 200ul
£332.50
A13615-100ul 100ul
£192.50
A13615-50ul 50ul
£113.75
A13615-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13615
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names EGF; HOMG4; URG; epidermal growth factor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 850-950 of human EGF (NP_001954.2).
Reactivity Human, Monkey
Gene ID 1950
Calculated MW 129kDa/133kDa
Observed MW 134kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCSEGYQGDGIHCLDIDECQLGEHSCGENASCTNTEGGYTCMCAGRLSEPGLI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents