EBF3 Polyclonal AntibodyEBF3 Polyclonal Antibody
Move your mouse over image or click to enlarge

EBF3 Polyclonal Antibody

Cat# Size Price Qty Buy
A15973-20ul 20ul
£77.00
A15973-50ul 50ul
£113.75
A15973-100ul 100ul
£192.50
A15973-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15973
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names EBF3; COE3; EBF-3; HADDS; O/E-2; OE-2; early B-cell factor 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EBF3 (NP_001005463.1).
Reactivity Human
Gene ID 253738
Calculated MW 60kDa/64kDa
Observed MW 58kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTSMNGYGSGAMASLGVPGSPGF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents