E2F5 Polyclonal AntibodyE2F5 Polyclonal Antibody
Move your mouse over image or click to enlarge

E2F5 Polyclonal Antibody

Cat# Size Price Qty Buy
A16042-20ul 20ul
£77.00
A16042-50ul 50ul
£113.75
A16042-100ul 100ul
£192.50
A16042-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16042
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names E2F5; E2F-5; transcription factor E2F5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 197-346 of human E2F5 (NP_001942.2).
Reactivity Human
Gene ID 1875
Calculated MW 20kDa/37kDa
Observed MW 38kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QLEVPIPEMGQNGQKKYQINLKSHSGPIHVLLINKESSSSKPVVFPVPPPDDLTQPSSQSLTPVTPQKSSMATQNLPEQHVSERSQALQQTSATDISSAGSISGDIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents