DYNLL2 Polyclonal AntibodyDYNLL2 Polyclonal Antibody
Move your mouse over image or click to enlarge

DYNLL2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13889-200ul 200ul
£332.50
A13889-100ul 100ul
£192.50
A13889-50ul 50ul
£113.75
A13889-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13889
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DYNLL2; DNCL1B; Dlc2; RSPH22; dynein light chain LC8-type 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of human DYNLL2 (NP_542408.1).
Reactivity Mouse, Rat
Gene ID 140735
Calculated MW 10kDa
Observed MW 13kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents