DYNLL1 Polyclonal AntibodyDYNLL1 Polyclonal Antibody
Move your mouse over image or click to enlarge

DYNLL1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14496-200ul 200ul
£332.50
A14496-100ul 100ul
£192.50
A14496-50ul 50ul
£113.75
A14496-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14496
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DYNLL1; DLC1; DLC8; DNCL1; DNCLC1; LC8; LC8a; PIN; hdlc1; dynein light chain LC8-type 1
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-89 of human DYNLL1 (NP_003737.1).
Reactivity Human, Mouse, Rat
Gene ID 8655
Calculated MW 10kDa
Observed MW 12kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 30651360
Sequence MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents