DUSP12 Polyclonal AntibodyDUSP12 Polyclonal Antibody
Move your mouse over image or click to enlarge

DUSP12 Polyclonal Antibody

Cat# Size Price Qty Buy
A13247-200ul 200ul
£332.50
A13247-100ul 100ul
£192.50
A13247-50ul 50ul
£113.75
A13247-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13247
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DUSP12; DUSP1; YVH1; dual specificity phosphatase 12
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-270 of human DUSP12 (NP_009171.1).
Reactivity Human, Mouse
Gene ID 11266
Calculated MW 37kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LMKTDQLPFEKAYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents