DLGAP5 Polyclonal AntibodyDLGAP5 Polyclonal Antibody
Move your mouse over image or click to enlarge

DLGAP5 Polyclonal Antibody

Cat# Size Price Qty Buy
A13575-200ul 200ul
£332.50
A13575-100ul 100ul
£192.50
A13575-50ul 50ul
£113.75
A13575-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13575
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DLGAP5; DLG7; HURP; DLG associated protein 5
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 547-846 of human DLGAP5 (NP_055565.3).
Reactivity Human, Mouse, Rat
Gene ID 9787
Calculated MW 85kDa/94kDa/95kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence KNVFRKKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPVKLFSGLSVSSEGPSQRLGTPKSVNKAVSQSRNEMGIPQQTTSPENAGPQNTKSEHVKKTLFLSIPESRSSIEDAQCPGLPDLIEENHVVNKTDLKVDCLSSERMSLPLLAGGVADDINTNKKEGISDVVEGMELNSSITSQDVLMSSPEKNTASQNSILEEGETKISQSELFDNKSLTTECHLLDSPGLNCSNPFTQLERRHQEHARHISFGGNLITFSPLQPGEF
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents