Human LL-37, Antibacterial Peptide AssayLite™Antibody (PerCP Conjugate)

Purified antibody validated for specificity and sensitivity.
Cat# Size Price Qty Buy
22445-05071 150 ug £390.00

Additional Information

Property Value or Rating
Manufacturer Assaypro, LLC.
Product Type Polyclonal, Primary Antibodies
Species Human
Assay Format IgG-PerCP Conjugate
Product Size 150 ug
Purity Affinity Purified
Presentation Lyophilized from PBS pH 7.4, 20 mg/ml BSA, 0.02% Sodium Azide, and 4% Trehalose
Storage 2-8C, Do Not Freeze
Host Rabbit
Immunogen [LL-37, 37 aa] conjugated to KLH
Antibody Type Polyclonal
Clone None
Isotype None
Conjugate PerCP conjugated
Applications FACS, IF
Entrez Gene 820
Omim 600474
UniProt P49913
UniGene Hs.51120
Alternate Names Cathelicidin Antimicrobial Peptide, Antibacterial Peptide LL-37, 18 kDa Cationic Antimicrobial Protein, CAP-18, hCAP-18, FALL-39 Peptide Antibiotic, Antibacterial Peptide FALL-39, HSD26, CAMP

Related Documents