Human LL-37, Antibacterial Peptide AssayLite™Antibody (APC Conjugate)Human LL-37, Antibacterial Peptide AssayLite™Antibody (APC Conjugate)
Move your mouse over image or click to enlarge

Human LL-37, Antibacterial Peptide AssayLite™Antibody (APC Conjugate)

Purified antibody validated for specificity and sensitivity.
Cat# Size Price Qty Buy
22445-05061 150 ug £350.00

Additional Information

Property Value or Rating
Manufacturer Assaypro, LLC.
Product Type Polyclonal, Primary Antibodies
Species Human
Assay Format IgG-APC Conjugate
Product Size 150 ug
Purity Affinity Purified
Presentation Lyophilized from PBS pH 7.4, 20 mg/ml BSA, 0.02% Sodium Azide, and 4% Trehalose
Storage 2-8C, Do Not Freeze
Host Rabbit
Immunogen [LL-37, 37 aa] conjugated to KLH
Antibody Type Polyclonal
Clone None
Isotype None
Conjugate Allophycocyanin (APC) conjugated
Applications FACS, ICC, IF, IHC
Entrez Gene 820
Omim 600474
UniProt P49913
UniGene Hs.51120
Alternate Names Cathelicidin Antimicrobial Peptide, Antibacterial Peptide LL-37, 18 kDa Cationic Antimicrobial Protein, CAP-18, hCAP-18, FALL-39 Peptide Antibiotic, Antibacterial Peptide FALL-39, HSD26, CAMP

Related Documents