DHODH Polyclonal AntibodyDHODH Polyclonal Antibody
Move your mouse over image or click to enlarge

DHODH Polyclonal Antibody

Cat# Size Price Qty Buy
A13295-200ul 200ul
£332.50
A13295-100ul 100ul
£192.50
A13295-50ul 50ul
£113.75
A13295-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13295
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DHODH; DHOdehase; POADS; URA1; dihydroorotate dehydrogenase (quinone)
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 116-395 of human DHODH (NP_001352.2).
Reactivity Human, Mouse, Rat
Gene ID 1723
Calculated MW 42kDa
Observed MW 43kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents