DGAT2 Polyclonal AntibodyDGAT2 Polyclonal Antibody
Move your mouse over image or click to enlarge

DGAT2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13891-200ul 200ul
£332.50
A13891-100ul 100ul
£192.50
A13891-50ul 50ul
£113.75
A13891-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13891
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DGAT2; ARAT; GS1999FULL; HMFN1045; diacylglycerol O-acyltransferase 2
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 113-388 of human DGAT2 (NP_115953.2).
Reactivity Human, Mouse, Rat
Gene ID 84649
Calculated MW 39kDa/43kDa
Observed MW 44kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents