DEF6 Polyclonal AntibodyDEF6 Polyclonal Antibody
Move your mouse over image or click to enlarge

DEF6 Polyclonal Antibody

Cat# Size Price Qty Buy
A14337-200ul 200ul
£332.50
A14337-100ul 100ul
£192.50
A14337-50ul 50ul
£113.75
A14337-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14337
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DEF6; IBP; SLAT; SWAP70L; DEF6, guanine nucleotide exchange factor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-330 of human DEF6 (NP_071330.3).
Reactivity Human, Mouse, Rat
Gene ID 50619
Calculated MW 73kDa
Observed MW 74kDa
Physical Appearance liquid
Purification Affinity purification
Sequence DGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTANRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRR
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents