DDX46 Polyclonal AntibodyDDX46 Polyclonal Antibody
Move your mouse over image or click to enlarge

DDX46 Polyclonal Antibody

Cat# Size Price Qty Buy
A4350-200ul 200ul
£332.50
A4350-100ul 100ul
£192.50
A4350-50ul 50ul
£113.75
A4350-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4350
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DDX46; PRPF5; Prp5; DEAD-box helicase 46
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 682-1031 of human DDX46 (NP_055644.2).
Reactivity Human, Mouse, Rat
Gene ID 9879
Calculated MW 117kDa
Observed MW 117kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDMAAPGTSSVPAPTAGNAEKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTILAPTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL
Sensitivity WB,1:500 - 1:1000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents