DDX31 Polyclonal AntibodyDDX31 Polyclonal Antibody
Move your mouse over image or click to enlarge

DDX31 Polyclonal Antibody

Cat# Size Price Qty Buy
A15892-20ul 20ul
£77.00
A15892-50ul 50ul
£113.75
A15892-100ul 100ul
£192.50
A15892-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15892
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DDX31; PPP1R25; DEAD-box helicase 31
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 652-851 of human DDX31 (NP_073616.6).
Reactivity Human
Gene ID 64794
Calculated MW 34kDa/64kDa/85kDa/94kDa
Observed MW 94kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EIKMEDILCVLTRDDCFKGKRWGAQKSHAVGPQEIRERATVLQTVFEDYVHSSERRVSWAKKALQSFIQAYATYPRELKHIFHVRSLHLGHVAKSFGLRDAPRNLSALTRKKRKAHVKRPDLHKKTQSKHSLAEILRSEYSSGMEADIAKVKKQNAPGEPGGRPLQHSLQPTPCFGRGKTLKWRKTQKGVQRDSKTSQKV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents