DCUN1D1 Polyclonal AntibodyDCUN1D1 Polyclonal Antibody
Move your mouse over image or click to enlarge

DCUN1D1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14587-200ul 200ul
£332.50
A14587-100ul 100ul
£192.50
A14587-50ul 50ul
£113.75
A14587-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14587
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DCUN1D1; DCNL1; DCUN1L1; RP42; SCCRO; SCRO; Tes3; DCN1-like protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 15-70 of human DCUN1D1 (NP_065691.2).
Reactivity Human, Mouse
Gene ID 54165
Calculated MW 30kDa
Observed MW 30kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents