DCTN5 Polyclonal AntibodyDCTN5 Polyclonal Antibody
Move your mouse over image or click to enlarge

DCTN5 Polyclonal Antibody

Cat# Size Price Qty Buy
A15915-20ul 20ul
£77.00
A15915-50ul 50ul
£113.75
A15915-100ul 100ul
£192.50
A15915-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15915
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DCTN5; dynactin subunit 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DCTN5 (NP_115875.1).
Reactivity Human, Mouse, Rat
Gene ID 84516
Calculated MW 9kDa/16kDa/20kDa
Observed MW 20kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents