DCAF7 Polyclonal AntibodyDCAF7 Polyclonal Antibody
Move your mouse over image or click to enlarge

DCAF7 Polyclonal Antibody

Cat# Size Price Qty Buy
A13392-200ul 200ul
£332.50
A13392-100ul 100ul
£192.50
A13392-50ul 50ul
£113.75
A13392-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13392
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DCAF7; AN11; HAN11; SWAN-1; WDR68; DDB1 and CUL4 associated factor 7
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-342 of human DCAF7 (NP_005819.3).
Reactivity Human, Mouse
Gene ID 10238
Calculated MW 16kDa/38kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents