DCAF13 Polyclonal AntibodyDCAF13 Polyclonal Antibody
Move your mouse over image or click to enlarge

DCAF13 Polyclonal Antibody

Cat# Size Price Qty Buy
A13213-200ul 200ul
£332.50
A13213-100ul 100ul
£192.50
A13213-50ul 50ul
£113.75
A13213-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13213
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names DCAF13; GM83; HSPC064; WDSOF1; Sof1; DDB1 and CUL4 associated factor 13
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 298-597 of human DCAF13 (NP_056235.4).
Reactivity Human, Mouse
Gene ID 25879
Calculated MW 10kDa/51kDa
Observed MW 51kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETFLLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVNRIKHSKPGSVPLVSEKKKHVVAVVK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents