Cat# | Size | Price | Qty | Buy |
---|---|---|---|---|
A4814-200ul | 200ul |
£332.50
|
||
A4814-100ul | 100ul |
£192.50
|
||
A4814-50ul | 50ul |
£113.75
|
||
A4814-20ul | 20ul |
£77.00
|
Additional Information
Property | Value or Rating |
---|---|
Manufacturer Cat# | A4814 |
Manufacturer | Abclonal Biotechnology |
Antibody Type | Polyclonal |
Alternate Names | DARS2; ASPRS; LBSL; MT-ASPRS; aspartate--tRNA ligase, mitochondrial |
Applications | IHC, WB |
Buffer | Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Conjugate | Unconjugated |
Host | Rabbit |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 406-645 of human DARS2 (NP_060592.2). |
Reactivity | Human, Mouse |
Gene ID | 55157 |
Calculated MW | 73kDa |
Observed MW | 74kDa |
Physical Appearance | liquid |
Purification | Affinity purification |
Sequence | ANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH |
Sensitivity | WB,1:200 - 1:2000|IHC,1:50 - 1:200 |
Storage | Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |