| Cat# | Size | Price | Qty | Buy |
|---|---|---|---|---|
| A4814-200ul | 200ul |
£332.50
|
||
| A4814-100ul | 100ul |
£192.50
|
||
| A4814-50ul | 50ul |
£113.75
|
||
| A4814-20ul | 20ul |
£77.00
|
Additional Information
| Property | Value or Rating |
|---|---|
| Manufacturer Cat# | A4814 |
| Manufacturer | Abclonal Biotechnology |
| Antibody Type | Polyclonal |
| Alternate Names | DARS2; ASPRS; LBSL; MT-ASPRS; aspartate--tRNA ligase, mitochondrial |
| Applications | IHC, WB |
| Buffer | Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Conjugate | Unconjugated |
| Host | Rabbit |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 406-645 of human DARS2 (NP_060592.2). |
| Reactivity | Human, Mouse |
| Gene ID | 55157 |
| Calculated MW | 73kDa |
| Observed MW | 74kDa |
| Physical Appearance | liquid |
| Purification | Affinity purification |
| Sequence | ANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH |
| Sensitivity | WB,1:200 - 1:2000|IHC,1:50 - 1:200 |
| Storage | Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
