CYP3A4 Polyclonal AntibodyCYP3A4 Polyclonal Antibody
Move your mouse over image or click to enlarge

CYP3A4 Polyclonal Antibody

Cat# Size Price Qty Buy
A14213-200ul 200ul
£332.50
A14213-100ul 100ul
£192.50
A14213-50ul 50ul
£113.75
A14213-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14213
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CYP3A4; CP33; CP34; CYP3A; CYP3A3; CYPIIIA3; CYPIIIA4; HLP; NF-25; P450C3; P450PCN1; cytochrome P450 3A4
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 244-503 of human CYP3A4 (NP_059488.2).
Reactivity Human, Mouse, Rat
Gene ID 1576
Calculated MW 57kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence EVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents