CYP11B2 Polyclonal AntibodyCYP11B2 Polyclonal Antibody
Move your mouse over image or click to enlarge

CYP11B2 Polyclonal Antibody

Cat# Size Price Qty Buy
A1443-200ul 200ul
£332.50
A1443-100ul 100ul
£192.50
A1443-50ul 50ul
£113.75
A1443-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1443
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CYP11B2; ALDOS; CPN2; CYP11B; CYP11BL; CYPXIB2; P-450C18; P450C18; P450aldo; cytochrome P450 11B2, mitochondrial
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 234-503 of human CYP11B2 (NP_000489.3).
Reactivity Human, Mouse, Rat
Gene ID 1585
Calculated MW 57kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Sensitivity WB,1:500 - 1:1000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents