CYLD Polyclonal AntibodyCYLD Polyclonal Antibody
Move your mouse over image or click to enlarge

CYLD Polyclonal Antibody

Cat# Size Price Qty Buy
A3821-200ul 200ul
£332.50
A3821-100ul 100ul
£192.50
A3821-50ul 50ul
£113.75
A3821-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3821
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CYLD; BRSS; CDMT; CYLD1; CYLDI; EAC; MFT; MFT1; SBS; TEM; USPL2; CYLD lysine 63 deubiquitinase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 654-953 of human CYLD (NP_001035877.1).
Reactivity Human, Mouse, Rat
Gene ID 1540
Calculated MW 107kDa
Observed MW 120kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents