Cyclin B1 Polyclonal AntibodyCyclin B1 Polyclonal Antibody
Move your mouse over image or click to enlarge

Cyclin B1 Polyclonal Antibody

Cat# Size Price Qty Buy
A16038-20ul 20ul
£77.00
A16038-50ul 50ul
£113.75
A16038-100ul 100ul
£192.50
A16038-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16038
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CCNB1; CCNB; cyclin B1
Applications IF, IHC, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 330 to the C-terminus of human Cyclin B1 (NP_114172.1).
Reactivity Human, Mouse, Rat
Gene ID 891
Calculated MW 44kDa/48kDa
Observed MW 55kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200|IP,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents