CYB5B Polyclonal AntibodyCYB5B Polyclonal Antibody
Move your mouse over image or click to enlarge

CYB5B Polyclonal Antibody

Cat# Size Price Qty Buy
A15900-20ul 20ul
£77.00
A15900-50ul 50ul
£113.75
A15900-100ul 100ul
£192.50
A15900-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15900
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CYB5B; CYB5-M; CYPB5M; OMB5; cytochrome b5 type B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 16-150 of human CYB5B (NP_085056.2).
Reactivity Human, Mouse, Rat
Gene ID 80777
Calculated MW 16kDa
Observed MW 20kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents