CXCR4 Polyclonal AntibodyCXCR4 Polyclonal Antibody
Move your mouse over image or click to enlarge

CXCR4 Polyclonal Antibody

Cat# Size Price Qty Buy
A13672-200ul 200ul
£332.50
A13672-100ul 100ul
£192.50
A13672-50ul 50ul
£113.75
A13672-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13672
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CXCR4; CD184; D2S201E; FB22; HM89; HSY3RR; LAP-3; LAP3; LCR1; LESTR; NPY3R; NPYR; NPYRL; NPYY3R; WHIM; WHIMS; C-X-C chemokine receptor type 4
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-42 of human CXCR4 (NP_001008540.1).
Reactivity Human, Mouse, Rat
Gene ID 7852
Calculated MW 39kDa/40kDa
Observed MW 41kDa/71kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNK
Sensitivity WB,1:500 - 1:1000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents