CXCL10 Polyclonal AntibodyCXCL10 Polyclonal Antibody
Move your mouse over image or click to enlarge

CXCL10 Polyclonal Antibody

Cat# Size Price Qty Buy
A1457-200ul 200ul
£332.50
A1457-100ul 100ul
£192.50
A1457-50ul 50ul
£113.75
A1457-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1457
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CXCL10; C7; IFI10; INP10; IP-10; SCYB10; crg-2; gIP-10; mob-1; C-X-C motif chemokine 10
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-98 of human CXCL10 (NP_001556.2).
Reactivity Human
Gene ID 3627
Calculated MW 10kDa
Observed MW 11kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents