CX3CL1 Polyclonal AntibodyCX3CL1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CX3CL1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14198-200ul 200ul
£332.50
A14198-100ul 100ul
£192.50
A14198-50ul 50ul
£113.75
A14198-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14198
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CX3CL1; ABCD-3; C3Xkine; CXC3; CXC3C; NTN; NTT; SCYD1; fractalkine; neurotactin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-180 of human CX3CL1 (NP_002987.1).
Reactivity Human, Rat
Gene ID 6376
Calculated MW 42kDa
Observed MW 100kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGP
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents