CTRL Polyclonal AntibodyCTRL Polyclonal Antibody
Move your mouse over image or click to enlarge

CTRL Polyclonal Antibody

Cat# Size Price Qty Buy
A3818-200ul 200ul
£332.50
A3818-100ul 100ul
£192.50
A3818-50ul 50ul
£113.75
A3818-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3818
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CTRL; CTRL1; chymotrypsin like
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 34-264 of human CTRL (NP_001898.1).
Reactivity Mouse
Gene ID 1506
Calculated MW 28kDa
Observed MW 28kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents