CTCF Polyclonal AntibodyCTCF Polyclonal Antibody
Move your mouse over image or click to enlarge

CTCF Polyclonal Antibody

Cat# Size Price Qty Buy
A13272-200ul 200ul
£332.50
A13272-100ul 100ul
£192.50
A13272-50ul 50ul
£113.75
A13272-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13272
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CTCF; MRD21; CCCTC-binding factor
Applications ChIP, IF, IHC, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human CTCF (NP_006556.1).
Reactivity Human, Mouse, Rat
Gene ID 10664
Calculated MW 45kDa/82kDa
Observed MW 140kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKPTKIKKK
Sensitivity WB,1:1000 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200|IP,1:50 - 1:100|ChIP,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents