CSTF2T Polyclonal AntibodyCSTF2T Polyclonal Antibody
Move your mouse over image or click to enlarge

CSTF2T Polyclonal Antibody

Cat# Size Price Qty Buy
A4540-200ul 200ul
£332.50
A4540-100ul 100ul
£192.50
A4540-50ul 50ul
£113.75
A4540-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4540
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CSTF2T; CstF-64T; cleavage stimulation factor subunit 2 tau variant
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 420-560 of human CSTF2T (NP_056050.1).
Reactivity Human, Mouse
Gene ID 23283
Calculated MW 64kDa
Observed MW 70kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TRAMETEVLETRVMERRGMETCAMETRGMEARGMDARGLEMRGPVPSSRGPMTGGIQGPGPINIGAGGPPQGPRQVPGISGVGNPGAGMQGTGIQGTGMQGAGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPS
Sensitivity WB,1:1000 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents