CST3 Polyclonal AntibodyCST3 Polyclonal Antibody
Move your mouse over image or click to enlarge

CST3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13291-200ul 200ul
£332.50
A13291-100ul 100ul
£192.50
A13291-50ul 50ul
£113.75
A13291-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13291
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CST3; ARMD11; HEL-S-2; cystatin-C
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-146 of human CST3 (NP_000090.1).
Reactivity Human, Mouse
Gene ID 1471
Calculated MW 15kDa
Observed MW 15kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents