CSNK1G1 Polyclonal AntibodyCSNK1G1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CSNK1G1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14133-200ul 200ul
£332.50
A14133-100ul 100ul
£192.50
A14133-50ul 50ul
£113.75
A14133-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14133
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CSNK1G1; CK1gamma1; casein kinase 1 gamma 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 298-422 of human CSNK1G1 (NP_071331.2).
Reactivity Human, Mouse
Gene ID 53944
Calculated MW 45kDa/48kDa
Observed MW 49kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKTAQRHK
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents