CSMD2 Polyclonal AntibodyCSMD2 Polyclonal Antibody
Move your mouse over image or click to enlarge

CSMD2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14229-200ul 200ul
£332.50
A14229-100ul 100ul
£192.50
A14229-50ul 50ul
£113.75
A14229-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14229
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CSMD2; dJ1007G16.1; dJ1007G16.2; dJ947L8.1; CUB and Sushi multiple domains 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 2050-2150 of human CSMD2 (NP_443128.2).
Reactivity Human, Mouse, Rat
Gene ID 114784
Calculated MW 380kDa
Observed MW 280kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TSHETTVYFHSDHSQNRPGFKLEYQDLTYSHQISSFLRGFDLSELERTNSTPPVAASYVWDLDPGCEAYELQECPDPEPFANGIVRGAGYNVGQSVTFECL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents