CSH1 Polyclonal AntibodyCSH1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CSH1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14528-200ul 200ul
£332.50
A14528-100ul 100ul
£192.50
A14528-50ul 50ul
£113.75
A14528-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14528
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CSH1; CS-1; CSA; CSMT; GHB3; PL; hCS-1; hCS-A; chorionic somatomammotropin hormone 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-207 of human CSH1 (NP_001308.1).
Reactivity Human
Gene ID 1442
Calculated MW 25kDa
Observed MW 23kDa
Physical Appearance liquid
Purification Affinity purification
Sequence VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQ
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents