CSF2RA Polyclonal AntibodyCSF2RA Polyclonal Antibody
Move your mouse over image or click to enlarge

CSF2RA Polyclonal Antibody

Cat# Size Price Qty Buy
A3167-200ul 200ul
£332.50
A3167-100ul 100ul
£192.50
A3167-50ul 50ul
£113.75
A3167-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3167
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CSF2RA; CD116; CDw116; CSF2R; CSF2RAX; CSF2RAY; CSF2RX; CSF2RY; GM-CSF-R-alpha; GMCSFR; GMR; SMDP4; colony stimulating factor 2 receptor alpha subunit
Applications IF
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-150 of human CSF2RA (NP_001155001.1).
Reactivity Human, Mouse
Gene ID 1438
Calculated MW 26kDa/31kDa/32kDa/38kDa/43kDa/46kDa/49kDa
Physical Appearance liquid
Purification Affinity purification
Sequence EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQY
Sensitivity IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents