CRY2 Polyclonal AntibodyCRY2 Polyclonal Antibody
Move your mouse over image or click to enlarge

CRY2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13289-200ul 200ul
£332.50
A13289-100ul 100ul
£192.50
A13289-50ul 50ul
£113.75
A13289-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13289
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CRY2; HCRY2; PHLL2; cryptochrome-2
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 455-614 of human CRY2 (NP_066940.2).
Reactivity Human
Gene ID 1408
Calculated MW 60kDa/66kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents