CRY1 Polyclonal AntibodyCRY1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CRY1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13662-200ul 200ul
£332.50
A13662-100ul 100ul
£192.50
A13662-50ul 50ul
£113.75
A13662-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13662
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CRY1; PHLL1; DSPD; cryptochrome-1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human CRY1 (NP_004066.1).
Reactivity Human, Mouse, Rat
Gene ID 1407
Calculated MW 66kDa
Observed MW 70kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents