CRIPT Polyclonal AntibodyCRIPT Polyclonal Antibody
Move your mouse over image or click to enlarge

CRIPT Polyclonal Antibody

Cat# Size Price Qty Buy
A14336-200ul 200ul
£332.50
A14336-100ul 100ul
£192.50
A14336-50ul 50ul
£113.75
A14336-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14336
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CRIPT; HSPC139; SSMDF; cysteine-rich PDZ-binding protein
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human CRIPT (NP_054890.1).
Reactivity Mouse, Rat
Gene ID 9419
Calculated MW 11kDa
Observed MW 11kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents