CREG1 Polyclonal AntibodyCREG1 Polyclonal Antibody
Move your mouse over image or click to enlarge

CREG1 Polyclonal Antibody

Cat# Size Price Qty Buy
A16081-20ul 20ul
£77.00
A16081-50ul 50ul
£113.75
A16081-100ul 100ul
£192.50
A16081-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16081
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CREG1; CREG; protein CREG1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human CREG1 (NP_003842.1).
Reactivity Mouse, Rat
Gene ID 8804
Calculated MW 24kDa
Observed MW 30kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LQLSVSNLQENPYATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents