CREBZF Polyclonal AntibodyCREBZF Polyclonal Antibody
Move your mouse over image or click to enlarge

CREBZF Polyclonal Antibody

Cat# Size Price Qty Buy
A3477-200ul 200ul
£332.50
A3477-100ul 100ul
£192.50
A3477-50ul 50ul
£113.75
A3477-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3477
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CREBZF; SMILE; ZF; CREB/ATF bZIP transcription factor
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-354 of human CREBZF (NP_001034707.1).
Reactivity Human, Mouse, Rat
Gene ID 58487
Calculated MW 37kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSRGGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents