CPT1C Polyclonal AntibodyCPT1C Polyclonal Antibody
Move your mouse over image or click to enlarge

CPT1C Polyclonal Antibody

Cat# Size Price Qty Buy
A13849-200ul 200ul
£332.50
A13849-100ul 100ul
£192.50
A13849-50ul 50ul
£113.75
A13849-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13849
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CPT1C; CATL1; CPT1-B; CPT1P; CPTI-B; CPTIC; SPG73; carnitine palmitoyltransferase 1C
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-400 of human CPT1C (NP_001129524.1).
Reactivity Mouse, Rat
Gene ID 126129
Calculated MW 81kDa/89kDa/90kDa
Observed MW 91kDa
Physical Appearance liquid
Purification Affinity purification
Sequence LYRHRLNRQEIPPTLLMGMRPLCSAQYEKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHSRNSLLSPRALEQQFQRILDDPSPACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents