CPLX4 Polyclonal AntibodyCPLX4 Polyclonal Antibody
Move your mouse over image or click to enlarge

CPLX4 Polyclonal Antibody

Cat# Size Price Qty Buy
A14464-200ul 200ul
£332.50
A14464-100ul 100ul
£192.50
A14464-50ul 50ul
£113.75
A14464-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14464
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names CPLX4; CPX-IV; CPXIV; complexin-4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human CPLX4 (NP_857637.1).
Reactivity Rat
Gene ID 339302
Calculated MW 18kDa
Observed MW 18kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAFLMKSMISNQVKNLGFGGGSEENKEEGGASDPAAAQGMTREEYEEYQKQMIEEKMERDAAFTQKKAERACLRVHLREKYRLPKSEMDENQIQMAGDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKEKAQATFTEIKQTAEQKCSVM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents